GMPPA antibody (N-Term)

Catalog No. ABIN631606

This Rabbit Polyclonal antibody specifically detects GMPPA in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GMPPA antibody (N-Term) (ABIN631606)

Target: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GMPPA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GMPPA Antibody

Binding Specificity: N-Term

Specificity: GMPPA antibody was raised against the N terminal of GMPPA

Purification: Affinity purified

Immunogen: GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GMPPA Blocking Peptide, (ABIN940461), is also available for use as a blocking control in assays to test for specificity of this GMPPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GMPPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GMPPA

Target: GMPPA (GDP-Mannose Pyrophosphorylase A (GMPPA))

Alternative Name: GMPPA

Background: GMPPA is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides.

Molecular Weight: 46 kDa (MW of target protein)