Keratin 75 antibody (N-Term)
-
- Target See all Keratin 75 (KRT75) Antibodies
- Keratin 75 (KRT75)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Keratin 75 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Cytokeratin 75 antibody was raised against the N terminal of KRT75
- Purification
- Affinity purified
- Immunogen
- Cytokeratin 75 antibody was raised using the N terminal of KRT75 corresponding to a region with amino acids MSRQSSITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRI
- Top Product
- Discover our top product KRT75 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Cytokeratin 75 Blocking Peptide, catalog no. 33R-6488, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Keratin 75 (KRT75)
- Alternative Name
- Cytokeratin 75 (KRT75 Products)
- Background
- This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.
- Molecular Weight
- 59 kDa (MW of target protein)
-