Keratin 75 antibody (Middle Region)

Catalog No. ABIN631612

This Rabbit Polyclonal antibody specifically detects Keratin 75 in WB. It exhibits reactivity toward Human.

Quick Overview for Keratin 75 antibody (Middle Region) (ABIN631612)

Target: Keratin 75 (KRT75)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Keratin 75 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Keratin 75 Antibody

Binding Specificity: Middle Region

Specificity: Cytokeratin 75 antibody was raised against the middle region of KRT75

Purification: Affinity purified

Immunogen: Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cytokeratin 75 Blocking Peptide, (ABIN5613109), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Keratin 75

Target: Keratin 75 (KRT75)

Alternative Name: Cytokeratin 75

Background: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells.

Molecular Weight: 59 kDa (MW of target protein)