HSPA4 antibody (N-Term)

Catalog No. ABIN631620

This anti-HSPA4 antibody is a Rabbit Polyclonal antibody detecting HSPA4 in WB. Suitable for Human, Mouse and Dog.

Quick Overview for HSPA4 antibody (N-Term) (ABIN631620)

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSPA4 Antibody

Binding Specificity: N-Term

Specificity: HSPA4 antibody was raised against the N terminal of HSPA4

Purification: Affinity purified

Immunogen: HSPA4 antibody was raised using the N terminal of HSPA4 corresponding to a region with amino acids PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA4 Blocking Peptide, (ABIN5614098), is also available for use as a blocking control in assays to test for specificity of this HSPA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA4

Target: HSPA4 (Heat Shock 70kDa Protein 4 (HSPA4))

Alternative Name: HSPA4

Background: HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.

Molecular Weight: 94 kDa (MW of target protein)