NUP155 antibody (N-Term)

Catalog No. ABIN631629

This anti-NUP155 antibody is a Rabbit Polyclonal antibody detecting NUP155 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for NUP155 antibody (N-Term) (ABIN631629)

Target: NUP155 (Nucleoporin 155kDa (NUP155))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP155 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NUP155 Antibody

Binding Specificity: N-Term

Specificity: NUP155 antibody was raised against the N terminal of NUP155

Purification: Affinity purified

Immunogen: NUP155 antibody was raised using the N terminal of NUP155 corresponding to a region with amino acids MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP155 Blocking Peptide, (ABIN5615084), is also available for use as a blocking control in assays to test for specificity of this NUP155 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP155 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP155

Target: NUP155 (Nucleoporin 155kDa (NUP155))

Alternative Name: NUP155

Background: Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.

Molecular Weight: 153 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus