NUP50 antibody (C-Term)

Catalog No. ABIN631630

Product Details anti-NUP50 Antibody

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NUP50 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NUP50 antibody was raised against the C terminal of NUP50

Purification: Affinity purified

Immunogen: NUP50 antibody was raised using the C terminal of NUP50 corresponding to a region with amino acids TTQSKPVSSPFPTKPLEGQAEGDSGECKGGDEEENDEPPKVVVTEVKEED

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NUP50 Blocking Peptide, catalog no. 33R-9330, is also available for use as a blocking control in assays to test for specificity of this NUP50 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NUP50

Target: NUP50 (Nucleoporin 50kDa (NUP50))

Alternative Name: NUP50 (NUP50 Products)

Background: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. NUP50 is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Tube Formation