PRAS40 antibody

Catalog No. ABIN631641

This anti-PRAS40 antibody is a Rabbit Polyclonal antibody detecting PRAS40 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PRAS40 antibody (ABIN631641)

Target: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRAS40 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRAS40 Antibody

Purification: Affinity purified

Immunogen: AKT1 S1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKT1S1 Blocking Peptide, (ABIN940040), is also available for use as a blocking control in assays to test for specificity of this AKT1S1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRAS40

Target: PRAS40 (AKT1S1) (AKT1 Substrate 1 (Proline-Rich) (AKT1S1))

Alternative Name: AKT1S1

Background: AKT1S1 may play an important role in phosphatidylinositol 3-kinase (PI3K)-AKT1 survival signaling. It is the substrate for AKT1 phosphorylation, but can also be activated by AKT1-independent mechanisms. Its role in survival signaling pathways may be modulated by oxidative stress.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Cell Size, Autophagy, BCR Signaling, Warburg Effect