SELENBP1 antibody (C-Term)

Catalog No. ABIN631644

This anti-SELENBP1 antibody is a Rabbit Polyclonal antibody detecting SELENBP1 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SELENBP1 antibody (C-Term) (ABIN631644)

Target: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SELENBP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SELENBP1 Antibody

Binding Specificity: C-Term

Specificity: SELENBP1 antibody was raised against the C terminal of SELENBP1

Purification: Affinity purified

Immunogen: SELENBP1 antibody was raised using the C terminal of SELENBP1 corresponding to a region with amino acids KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SELENBP1 Blocking Peptide, (ABIN939990), is also available for use as a blocking control in assays to test for specificity of this SELENBP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SELENBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SELENBP1

Target: SELENBP1 (Selenium Binding Protein 1 (SELENBP1))

Alternative Name: SELENBP1

Background: SELENBP1 belongs to the selenium-binding protein family. Selenium is an essential nutrient that exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. It has been proposed that the effects of selenium in preventing cancer and neurologic diseases may be mediated by selenium-binding proteins.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation