G2E3 antibody (N-Term)

Catalog No. ABIN631665

This anti-G2E3 antibody is a Rabbit Polyclonal antibody detecting G2E3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for G2E3 antibody (N-Term) (ABIN631665)

Target: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This G2E3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-G2E3 Antibody

Binding Specificity: N-Term

Specificity: KIAA1333 antibody was raised against the N terminal of KIAA1333

Purification: Affinity purified

Immunogen: KIAA1333 antibody was raised using the N terminal of KIAA1333 corresponding to a region with amino acids IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA1333 Blocking Peptide, (ABIN939601), is also available for use as a blocking control in assays to test for specificity of this KIAA1333 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1333 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for G2E3

Target: G2E3 (G2/M-Phase Specific E3 Ubiquitin Protein Ligase (G2E3))

Alternative Name: KIAA1333

Background: KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Molecular Weight: 80 kDa (MW of target protein)