PDZK1 antibody (N-Term)

Catalog No. ABIN631670

The Rabbit Polyclonal anti-PDZK1 antibody has been validated for WB. It is suitable to detect PDZK1 in samples from Human and Mouse.

Quick Overview for PDZK1 antibody (N-Term) (ABIN631670)

Target: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDZK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDZK1 Antibody

Binding Specificity: N-Term

Specificity: PDZK1 antibody was raised against the n terminal of PDZK1

Purification: Affinity purified

Immunogen: PDZK1 antibody was raised using the N terminal of PDZK1 corresponding to a region with amino acids MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDZK1 Blocking Peptide, (ABIN5615301), is also available for use as a blocking control in assays to test for specificity of this PDZK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDZK1

Target: PDZK1 (PDZ Domain Containing 1 (PDZK1))

Alternative Name: PDZK1

Background: PDZK1 is a scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. It may be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, it may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins.

Molecular Weight: 41 kDa (MW of target protein)