PES1 antibody

Catalog No. ABIN631680

Product Details anti-PES1 Antibody

Target: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PES1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PES1 Blocking Peptide, catalog no. 33R-4489, is also available for use as a blocking control in assays to test for specificity of this PES1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PES1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PES1

Target: PES1 (Pescadillo Ribosomal Biogenesis Factor 1 (PES1))

Alternative Name: PES1 (PES1 Products)

Synonyms: PES antibody, pes antibody, pes1 antibody, pescadillo ribosomal biogenesis factor 1 antibody, pescadillo ribosomal biogenesis factor 1 S homeolog antibody, Pescadillo antibody, PES1 antibody, Pes1 antibody, pes1.S antibody, pesc antibody

Background: PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.

Molecular Weight: 68 kDa (MW of target protein)