APRT antibody (N-Term)

Catalog No. ABIN631682

Product Details anti-APRT Antibody

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APRT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: APRT antibody was raised against the N terminal of APRT

Purification: Affinity purified

Immunogen: APRT antibody was raised using the N terminal of APRT corresponding to a region with amino acids ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

APRT Blocking Peptide, catalog no. 33R-1105, is also available for use as a blocking control in assays to test for specificity of this APRT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APRT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APRT

Target: APRT (Adenine Phosphoribosyltransferase (APRT))

Alternative Name: APRT (APRT Products)

Synonyms: Tb07.43M14.200 antibody, Tb07.43M14.180 antibody, C85684 antibody, AMP antibody, APRTD antibody, adenine phosphoribosyltransferase antibody, adenine phosphoribosyl transferase antibody, CND05020 antibody, Tb927.7.1790 antibody, Tb927.7.1780 antibody, Arnit_0941 antibody, Saut_1231 antibody, Fbal_1180 antibody, PH_RS07970 antibody, PF_RS08760 antibody, PAB_RS02560 antibody, Aprt antibody, APRT antibody

Background: Adenine phosphoribosyltransferase (APRT) belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process