DCK antibody (Middle Region)

Catalog No. ABIN631701

This anti-DCK antibody is a Rabbit Polyclonal antibody detecting DCK in WB. Suitable for Human and Mouse.

Quick Overview for DCK antibody (Middle Region) (ABIN631701)

Target: DCK (Deoxycytidine Kinase (DCK))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DCK Antibody

Binding Specificity: Middle Region

Specificity: DCK antibody was raised against the middle region of DCK

Purification: Affinity purified

Immunogen: DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DCK Blocking Peptide, (ABIN5613135), is also available for use as a blocking control in assays to test for specificity of this DCK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCK

Target: DCK (Deoxycytidine Kinase (DCK))

Alternative Name: DCK

Background: Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Molecular Weight: 30 kDa (MW of target protein)