GNA12 antibody

Catalog No. ABIN631704

Product Details anti-GNA12 Antibody

Target: GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNA12 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GNA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFQLYVPALSALWRDSGIREAFSRRSEFQLGESVKYFLDNLDRIGQLNYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNA12 Blocking Peptide, catalog no. 33R-9073, is also available for use as a blocking control in assays to test for specificity of this GNA12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNA12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNA12

Target: GNA12 (Guanine Nucleotide Binding Protein (G Protein) alpha 12 (GNA12))

Alternative Name: GNA12 (GNA12 Products)

Synonyms: NNX3 antibody, RMP antibody, gep antibody, gna12 antibody, gna12l antibody, AI414047 antibody, AI504261 antibody, Galpha12 antibody, G protein subunit alpha 12 antibody, guanine nucleotide binding protein (G protein) alpha 12a antibody, guanine nucleotide binding protein, alpha 12 antibody, GNA12 antibody, Gna12 antibody, gna12a antibody

Background: GNA12 belongs to the G-alpha family. G(12) subfamily. Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Molecular Weight: 44 kDa (MW of target protein)