GPD1L antibody (Middle Region)

Catalog No. ABIN631705

This Rabbit Polyclonal antibody specifically detects GPD1L in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GPD1L antibody (Middle Region) (ABIN631705)

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPD1L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GPD1L Antibody

Binding Specificity: Middle Region

Specificity: GPD1 L antibody was raised against the middle region of GPD1

Purification: Affinity purified

Immunogen: GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPD1L Blocking Peptide, (ABIN937924), is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPD1L

Target: GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))

Alternative Name: GPD1L

Background: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Molecular Weight: 38 kDa (MW of target protein)