GPD1L antibody (Middle Region)
-
- Target See all GPD1L Antibodies
- GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPD1L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GPD1 L antibody was raised against the middle region of GPD1
- Purification
- Affinity purified
- Immunogen
- GPD1 L antibody was raised using the middle region of GPD1 corresponding to a region with amino acids ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV
- Top Product
- Discover our top product GPD1L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPD1L Blocking Peptide, catalog no. 33R-2538, is also available for use as a blocking control in assays to test for specificity of this GPD1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPD1L (Glycerol-3-Phosphate Dehydrogenase 1-Like (GPD1L))
- Alternative Name
- GPD1L (GPD1L Products)
- Synonyms
- wu:fi13g03 antibody, wu:fi45b08 antibody, zgc:92580 antibody, GPD1-L antibody, 2210409H23Rik antibody, D9Ertd660e antibody, RGD1560123 antibody, glycerol-3-phosphate dehydrogenase 1 like antibody, glycerol-3-phosphate dehydrogenase 1-like antibody, glycerol-3-phosphate dehydrogenase 1 like L homeolog antibody, gpd1l antibody, GPD1L antibody, gpd1l.L antibody, Gpd1l antibody
- Background
- GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).
- Molecular Weight
- 38 kDa (MW of target protein)
-