BPNT1 antibody

Catalog No. ABIN631707

This anti-BPNT1 antibody is a Rabbit Polyclonal antibody detecting BPNT1 in WB. Suitable for Human.

Quick Overview for BPNT1 antibody (ABIN631707)

Target: BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BPNT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BPNT1 Antibody

Purification: Affinity purified

Immunogen: BPNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BPNT1 Blocking Peptide, (ABIN937539), is also available for use as a blocking control in assays to test for specificity of this BPNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BPNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BPNT1

Target: BPNT1 (3'(2'), 5'-Bisphosphate Nucleotidase 1 (BPNT1))

Alternative Name: BPNT1

Background: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Inositol Metabolic Process