ELAC1 antibody
-
- Target See all ELAC1 Antibodies
- ELAC1
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ELAC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQL
- Top Product
- Discover our top product ELAC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ELAC1 Blocking Peptide, catalog no. 33R-6471, is also available for use as a blocking control in assays to test for specificity of this ELAC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELAC1
- Alternative Name
- ELAC1 (ELAC1 Products)
- Synonyms
- ELAC1 antibody, zgc:91956 antibody, 2610018O07Rik antibody, 8430417G19Rik antibody, D29 antibody, elaC ribonuclease Z 1 antibody, elac1 antibody, ELAC1 antibody, Elac1 antibody
- Background
- ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
- Molecular Weight
- 40 kDa (MW of target protein)
-