GPD1 antibody

Catalog No. ABIN631716

This anti-GPD1 antibody is a Rabbit Polyclonal antibody detecting GPD1 in WB. Suitable for Human.

Quick Overview for GPD1 antibody (ABIN631716)

Target: GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GPD1 Antibody

Purification: Affinity purified

Immunogen: GPD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKELLNGQKLQGP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPD1 Blocking Peptide, (ABIN5613829), is also available for use as a blocking control in assays to test for specificity of this GPD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPD1

Target: GPD1 (Glycerol-3-Phosphate Dehydrogenase 1 (Soluble) (GPD1))

Alternative Name: GPD1

Background: GPD1L belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family. Defects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) and sudden infant death syndrome (SIDS).

Molecular Weight: 37 kDa (MW of target protein)