TRAPPC6B antibody (Middle Region)

Catalog No. ABIN631728

This anti-TRAPPC6B antibody is a Rabbit Polyclonal antibody detecting TRAPPC6B in WB. Suitable for Human, Mouse and Rat.

Quick Overview for TRAPPC6B antibody (Middle Region) (ABIN631728)

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAPPC6B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRAPPC6B Antibody

Binding Specificity: Middle Region

Specificity: TRAPPC6 B antibody was raised against the middle region of TRAPPC6

Purification: Affinity purified

Immunogen: TRAPPC6 B antibody was raised using the middle region of TRAPPC6 corresponding to a region with amino acids TTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPACKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAPPC6B Blocking Peptide, (ABIN5616768), is also available for use as a blocking control in assays to test for specificity of this TRAPPC6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAPPC6B

Target: TRAPPC6B (Trafficking Protein Particle Complex 6B (TRAPPC6B))

Alternative Name: TRAPPC6B

Background: TRAPPC6B is a component of TRAPP complexes, which are tethering complexes involved in vesicle transport.

Molecular Weight: 15 kDa (MW of target protein)