RCC2 antibody (Middle Region)

Catalog No. ABIN631742

The Rabbit Polyclonal anti-RCC2 antibody has been validated for WB. It is suitable to detect RCC2 in samples from Human, Mouse and Rat.

Quick Overview for RCC2 antibody (Middle Region) (ABIN631742)

Target: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RCC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RCC2 Antibody

Binding Specificity: Middle Region

Specificity: RCC2 antibody was raised against the middle region of RCC2

Purification: Affinity purified

Immunogen: RCC2 antibody was raised using the middle region of RCC2 corresponding to a region with amino acids RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RCC2 Blocking Peptide, (ABIN5615814), is also available for use as a blocking control in assays to test for specificity of this RCC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RCC2

Target: RCC2 (Regulator of Chromosome Condensation 2 (RCC2))

Alternative Name: RCC2

Background: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Molecular Weight: 56 kDa (MW of target protein)