SAE1 antibody (N-Term)

Catalog No. ABIN631747

This Rabbit Polyclonal antibody specifically detects SAE1 in WB. It exhibits reactivity toward Human.

Quick Overview for SAE1 antibody (N-Term) (ABIN631747)

Target: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAE1 Antibody

Binding Specificity: N-Term

Specificity: SAE1 antibody was raised against the N terminal of SAE1

Purification: Affinity purified

Immunogen: SAE1 antibody was raised using the N terminal of SAE1 corresponding to a region with amino acids MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAE1 Blocking Peptide, (ABIN5615993), is also available for use as a blocking control in assays to test for specificity of this SAE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAE1

Target: SAE1 (SUMO1 Activating Enzyme Subunit 1 (SAE1))

Alternative Name: SAE1

Background: Posttranslational modification of proteins by the addition of the small protein SUMO, or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins.

Molecular Weight: 38 kDa (MW of target protein)