GPN2 antibody (Middle Region)
-
- Target See all GPN2 Antibodies
- GPN2 (GPN-Loop GTPase 2 (GPN2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GPN2 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- GPN2 antibody was raised against the middle region of GPN2
- Purification
- Affinity purified
- Immunogen
- GPN2 antibody was raised using the middle region of GPN2 corresponding to a region with amino acids VLQAVDKANGYCFRAQEQRSLEAMMSAAMGADFHFSSTLGIQEKYLAPSN
- Top Product
- Discover our top product GPN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GPN2 Blocking Peptide, catalog no. 33R-9680, is also available for use as a blocking control in assays to test for specificity of this GPN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GPN2 (GPN-Loop GTPase 2 (GPN2))
- Alternative Name
- GPN2 (GPN2 Products)
- Background
- The function of GPN protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 34 kDa (MW of target protein)
-