MASA antibody (N-Term)

Catalog No. ABIN631750

This Rabbit Polyclonal antibody specifically detects MASA in WB. It exhibits reactivity toward Human.

Quick Overview for MASA antibody (N-Term) (ABIN631750)

Target: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MASA antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MASA Antibody

Binding Specificity: N-Term

Specificity: ENOPH1 antibody was raised against the N terminal of ENOPH1

Purification: Affinity purified

Immunogen: ENOPH1 antibody was raised using the N terminal of ENOPH1 corresponding to a region with amino acids IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENOPH1 Blocking Peptide, (ABIN939323), is also available for use as a blocking control in assays to test for specificity of this ENOPH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOPH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MASA

Target: MASA (ENOPH1) (Enolase-Phosphatase 1 (ENOPH1))

Alternative Name: ENOPH1

Background: ENOPH1 is a bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).

Molecular Weight: 29 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process