Tiparp antibody

Catalog No. ABIN631753

Product Details anti-Tiparp Antibody

Target: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tiparp antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TIPARP antibody was raised using a synthetic peptide corresponding to a region with amino acids LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TIPARP Blocking Peptide, catalog no. 33R-5107, is also available for use as a blocking control in assays to test for specificity of this TIPARP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIPARP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tiparp

Target: Tiparp (TCDD-Inducible Poly(ADP-Ribose) Polymerase (Tiparp))

Alternative Name: TIPARP (Tiparp Products)

Synonyms: TIPARP antibody, fc03g05 antibody, sb:cb841 antibody, si:dkey-33k14.4 antibody, wu:fc03g05 antibody, zgc:153056 antibody, ddf1 antibody, parp7 antibody, parp-1 antibody, parp-7 antibody, ARTD14 antibody, PARP7 antibody, pART14 antibody, AW558171 antibody, RM1 antibody, TCDD inducible poly(ADP-ribose) polymerase antibody, TCDD-inducible poly(ADP-ribose) polymerase antibody, TCDD-inducible poly [ADP-ribose] polymerase antibody, TIPARP antibody, tiparp antibody, LOC100018933 antibody, Tiparp antibody

Background: TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor, repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling