ELAC1 antibody

Catalog No. ABIN631754

The Rabbit Polyclonal anti-ELAC1 antibody has been validated for WB. It is suitable to detect ELAC1 in samples from Human.

Quick Overview for ELAC1 antibody (ABIN631754)

Target: ELAC1

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELAC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ELAC1 Antibody

Purification: Affinity purified

Immunogen: ELAC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELAC1 Blocking Peptide, (ABIN940324), is also available for use as a blocking control in assays to test for specificity of this ELAC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELAC1

Target: ELAC1

Alternative Name: ELAC1

Background: ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.

Molecular Weight: 40 kDa (MW of target protein)