PRR19 antibody (N-Term)

Catalog No. ABIN631767

The Rabbit Polyclonal anti-PRR19 antibody (ABIN631767) specifically detects PRR19 in WB. The antibody is reactive with Human samples.

Quick Overview for PRR19 antibody (N-Term) (ABIN631767)

Target: PRR19 (Proline Rich 19 (PRR19))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRR19 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRR19 Antibody

Binding Specificity: N-Term

Specificity: MGC70924 antibody was raised against the N terminal Of Mgc70924

Purification: Affinity purified

Immunogen: MGC70924 antibody was raised using the N terminal Of Mgc70924 corresponding to a region with amino acids MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC70924 Blocking Peptide, (ABIN5614756), is also available for use as a blocking control in assays to test for specificity of this MGC70924 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC70924 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRR19

Target: PRR19 (Proline Rich 19 (PRR19))

Alternative Name: MGC70924

Background: The function of MGC70924 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)