Primary Retinal Dysplasia (PRD) (Middle Region) antibody

Catalog No. ABIN631772

The Rabbit Polyclonal anti-Primary Retinal Dysplasia antibody is suitable to detect Primary Retinal Dysplasia in samples from Drosophila melanogaster. It has been validated for WB.

Quick Overview for Primary Retinal Dysplasia (PRD) (Middle Region) antibody (ABIN631772)

Target: Primary Retinal Dysplasia (PRD)

Reactivity: Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: PRD antibody was raised against the middle region of PRD

Purification: Affinity purified

Immunogen: PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRD Blocking Peptide, (ABIN5615532), is also available for use as a blocking control in assays to test for specificity of this PRD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Primary Retinal Dysplasia (PRD)

Alternative Name: PRD

Background: Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.

Molecular Weight: 65 kDa (MW of target protein)