Lipin 1 antibody (N-Term)

Catalog No. ABIN631777

This Rabbit Polyclonal antibody specifically detects Lipin 1 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for Lipin 1 antibody (N-Term) (ABIN631777)

Target: Lipin 1 (LPIN1)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lipin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Lipin 1 Antibody

Binding Specificity: N-Term

Specificity: Lipin 1 antibody was raised against the N terminal of LPIN1

Purification: Affinity purified

Immunogen: Lipin 1 antibody was raised using the N terminal of LPIN1 corresponding to a region with amino acids SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipin 1 Blocking Peptide, (ABIN5614467), is also available for use as a blocking control in assays to test for specificity of this Lipin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPIN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lipin 1

Target: Lipin 1 (LPIN1)

Alternative Name: Lipin 1

Background: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process