UCHL5 antibody (Middle Region)
-
- Target See all UCHL5 Antibodies
- UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UCHL5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- UCHL5 antibody was raised against the middle region of UCHL5
- Purification
- Affinity purified
- Immunogen
- UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK
- Top Product
- Discover our top product UCHL5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
UCHL5 Blocking Peptide, catalog no. 33R-1959, is also available for use as a blocking control in assays to test for specificity of this UCHL5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))
- Alternative Name
- UCHL5 (UCHL5 Products)
- Synonyms
- zgc:85615 antibody, wu:fj17f09 antibody, uch37 antibody, cgi-70 antibody, DKFZp459M0513 antibody, 5830413B11Rik antibody, Uch37 antibody, CGI-70 antibody, INO80R antibody, UCH-L5 antibody, UCH37 antibody, ubiquitin carboxyl-terminal hydrolase L5 antibody, ubiquitin C-terminal hydrolase L5 antibody, ubiquitin C-terminal hydrolase L5 L homeolog antibody, ubiquitin carboxyl-terminal esterase L5 antibody, uchl5 antibody, UCHL5 antibody, uchl5.L antibody, Uchl5 antibody
- Background
- UCHL5 is the deubiquitinating enzyme associated with the proteasome.
- Molecular Weight
- 37 kDa (MW of target protein)
-