UCHL5 antibody (Middle Region)

Catalog No. ABIN631781

Product Details anti-UCHL5 Antibody

Target: UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UCHL5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UCHL5 antibody was raised against the middle region of UCHL5

Purification: Affinity purified

Immunogen: UCHL5 antibody was raised using the middle region of UCHL5 corresponding to a region with amino acids DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCHL5 Blocking Peptide, catalog no. 33R-1959, is also available for use as a blocking control in assays to test for specificity of this UCHL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UCHL5

Target: UCHL5 (Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5))

Alternative Name: UCHL5 (UCHL5 Products)

Synonyms: zgc:85615 antibody, wu:fj17f09 antibody, uch37 antibody, cgi-70 antibody, DKFZp459M0513 antibody, 5830413B11Rik antibody, Uch37 antibody, CGI-70 antibody, INO80R antibody, UCH-L5 antibody, UCH37 antibody, ubiquitin carboxyl-terminal hydrolase L5 antibody, ubiquitin C-terminal hydrolase L5 antibody, ubiquitin C-terminal hydrolase L5 L homeolog antibody, ubiquitin carboxyl-terminal esterase L5 antibody, uchl5 antibody, UCHL5 antibody, uchl5.L antibody, Uchl5 antibody

Background: UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Molecular Weight: 37 kDa (MW of target protein)