YTHDF3 antibody (N-Term)

Catalog No. ABIN631782

This anti-YTHDF3 antibody is a Rabbit Polyclonal antibody detecting YTHDF3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for YTHDF3 antibody (N-Term) (ABIN631782)

Target: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This YTHDF3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-YTHDF3 Antibody

Binding Specificity: N-Term

Specificity: YTHDF3 antibody was raised against the N terminal of YTHDF3

Purification: Affinity purified

Immunogen: YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

YTHDF3 Blocking Peptide, (ABIN5617062), is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for YTHDF3

Target: YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))

Alternative Name: YTHDF3

Background: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Molecular Weight: 64 kDa (MW of target protein)