RPL10A antibody (Middle Region)

Catalog No. ABIN631783

This Rabbit Polyclonal antibody specifically detects RPL10A in WB. It exhibits reactivity toward Human.

Quick Overview for RPL10A antibody (Middle Region) (ABIN631783)

Target: RPL10A (Ribosomal Protein L10a (RPL10A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL10A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPL10A Antibody

Binding Specificity: Middle Region

Specificity: RPL10 A antibody was raised against the middle region of RPL10

Purification: Affinity purified

Immunogen: RPL10 A antibody was raised using the middle region of RPL10 corresponding to a region with amino acids YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL10A Blocking Peptide, (ABIN936021), is also available for use as a blocking control in assays to test for specificity of this RPL10A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL10A

Target: RPL10A (Ribosomal Protein L10a (RPL10A))

Alternative Name: RPL10A

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L1P family of ribosomal proteins. It is located in the cytoplasm.

Molecular Weight: 25 kDa (MW of target protein)