DCAF12 antibody (N-Term)

Catalog No. ABIN631786

This Rabbit Polyclonal antibody specifically detects DCAF12 in WB. It exhibits reactivity toward Human.

Quick Overview for DCAF12 antibody (N-Term) (ABIN631786)

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DCAF12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DCAF12 Antibody

Binding Specificity: N-Term

Specificity: WDR40 A antibody was raised against the N terminal of WDR40

Purification: Affinity purified

Immunogen: WDR40 A antibody was raised using the N terminal of WDR40 corresponding to a region with amino acids ARKVVSRKRKAPASPGAGSDAQGPQFGWDHSLHKRKRLPPVKRSLVYYLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR40A Blocking Peptide, (ABIN936867), is also available for use as a blocking control in assays to test for specificity of this WDR40A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DCAF12

Target: DCAF12 (DDB1 and CUL4 Associated Factor 12 (DCAF12))

Alternative Name: WDR40A

Background: WDR40A is believed to be involved in protein binding.

Molecular Weight: 50 kDa (MW of target protein)