ATXN7L1 antibody (Middle Region)

Catalog No. ABIN631793

The Rabbit Polyclonal anti-ATXN7L1 antibody has been validated for WB. It is suitable to detect ATXN7L1 in samples from Human and Mouse.

Quick Overview for ATXN7L1 antibody (Middle Region) (ABIN631793)

Target: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATXN7L1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ATXN7L1 Antibody

Binding Specificity: Middle Region

Specificity: ATXN7 L1 antibody was raised against the middle region of ATXN7 1

Purification: Affinity purified

Immunogen: ATXN7 L1 antibody was raised using the middle region of ATXN7 1 corresponding to a region with amino acids KVPSPEAFLGKPWSSWIDAAKLHCSDNVDLEEAGKEGGKSREVMRLNKED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ATXN7L1 Blocking Peptide, (ABIN940103), is also available for use as a blocking control in assays to test for specificity of this ATXN7L1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATXN0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATXN7L1

Target: ATXN7L1 (Ataxin 7-Like 1 (ATXN7L1))

Alternative Name: ATXN7L1

Background: The function of ATXN7L1 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 16 kDa (MW of target protein)