LRRC57 antibody (N-Term)

Catalog No. ABIN631803

This anti-LRRC57 antibody is a Rabbit Polyclonal antibody detecting LRRC57 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for LRRC57 antibody (N-Term) (ABIN631803)

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC57 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC57 Antibody

Binding Specificity: N-Term

Specificity: LRRC57 antibody was raised against the N terminal of LRRC57

Purification: Affinity purified

Immunogen: LRRC57 antibody was raised using the N terminal of LRRC57 corresponding to a region with amino acids MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC57 Blocking Peptide, (ABIN5614581), is also available for use as a blocking control in assays to test for specificity of this LRRC57 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC57

Target: LRRC57 (Leucine Rich Repeat Containing 57 (LRRC57))

Alternative Name: LRRC57

Background: LRRC57 is a member of the leucine-rich repeat family of proteins, which are known to be involved in protein-protein interactions.

Molecular Weight: 27 kDa (MW of target protein)