ALOX12 antibody (C-Term)

Catalog No. ABIN631808

The Rabbit Polyclonal anti-ALOX12 antibody has been validated for WB. It is suitable to detect ALOX12 in samples from Human.

Quick Overview for ALOX12 antibody (C-Term) (ABIN631808)

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALOX12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ALOX12 Antibody

Binding Specificity: C-Term

Specificity: ALOX12 antibody was raised against the C terminal of ALOX12

Purification: Affinity purified

Immunogen: ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALOX12 Blocking Peptide, (ABIN5612028), is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALOX12

Target: ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))

Alternative Name: ALOX12

Background: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Molecular Weight: 76 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity