ALOX12 antibody (C-Term)
-
- Target See all ALOX12 Antibodies
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALOX12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALOX12 antibody was raised against the C terminal of ALOX12
- Purification
- Affinity purified
- Immunogen
- ALOX12 antibody was raised using the C terminal of ALOX12 corresponding to a region with amino acids MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF
- Top Product
- Discover our top product ALOX12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALOX12 Blocking Peptide, catalog no. 33R-6077, is also available for use as a blocking control in assays to test for specificity of this ALOX12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALOX12 (Arachidonate 12-Lipoxygenase (ALOX12))
- Alternative Name
- ALOX12 (ALOX12 Products)
- Background
- ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.
- Molecular Weight
- 76 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-