STAMBPL1 antibody (N-Term)

Catalog No. ABIN631818

This anti-STAMBPL1 antibody is a Rabbit Polyclonal antibody detecting STAMBPL1 in WB. Suitable for Human.

Quick Overview for STAMBPL1 antibody (N-Term) (ABIN631818)

Target: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STAMBPL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STAMBPL1 Antibody

Binding Specificity: N-Term

Specificity: STAMBPL1 antibody was raised against the N terminal of STAMBPL1

Purification: Affinity purified

Immunogen: STAMBPL1 antibody was raised using the N terminal of STAMBPL1 corresponding to a region with amino acids MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STAMBPL1 Blocking Peptide, (ABIN5616412), is also available for use as a blocking control in assays to test for specificity of this STAMBPL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STAMBPL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STAMBPL1

Target: STAMBPL1 (STAM Binding Protein-Like 1 (STAMBPL1))

Alternative Name: STAMBPL1

Background: STAMBPL1 is a zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains.

Molecular Weight: 50 kDa (MW of target protein)