PHYHIP antibody (N-Term)
-
- Target See all PHYHIP Antibodies
- PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHYHIP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PHYHIP antibody was raised against the N terminal of PHYHIP
- Purification
- Affinity purified
- Immunogen
- PHYHIP antibody was raised using the N terminal of PHYHIP corresponding to a region with amino acids KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL
- Top Product
- Discover our top product PHYHIP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHYHIP Blocking Peptide, catalog no. 33R-4371, is also available for use as a blocking control in assays to test for specificity of this PHYHIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYHIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHYHIP (Phytanoyl-CoA 2-Hydroxylase Interacting Protein (PHYHIP))
- Alternative Name
- PHYHIP (PHYHIP Products)
- Synonyms
- PHYHIP antibody, DYRK1AP3 antibody, PAHX-AP antibody, PAHXAP1 antibody, AW049870 antibody, C630010D02Rik antibody, Lnap1ip antibody, PAHX-AP1 antibody, phytanoyl-CoA 2-hydroxylase interacting protein antibody, phytanoyl-CoA hydroxylase interacting protein antibody, PHYHIP antibody, phyhip antibody, Phyhip antibody
- Background
- PHYHIP interacts with PHYH suggests a role in the development of the central system.
- Molecular Weight
- 38 kDa (MW of target protein)
-