ZFP14 antibody (N-Term)

Catalog No. ABIN631822

This Rabbit Polyclonal antibody specifically detects ZFP14 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for ZFP14 antibody (N-Term) (ABIN631822)

Target: ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZFP14 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZFP14 Antibody

Binding Specificity: N-Term

Specificity: ZNF14 antibody was raised against the N terminal of ZNF14

Purification: Affinity purified

Immunogen: ZNF14 antibody was raised using the N terminal of ZNF14 corresponding to a region with amino acids IYYQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQC

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZNF14 Blocking Peptide, (ABIN939617), is also available for use as a blocking control in assays to test for specificity of this ZNF14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZFP14

Target: ZFP14 (Zinc Finger Protein 14 Homolog (ZFP14))

Alternative Name: ZNF14

Background: ZNF14 contains a zinc finger and a Kruppel-associated box (KRAB) domain. KRAB domain is known to be involved in the transcriptional repression of a number of zinc finger proteins.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin