FBXW10 antibody (Middle Region)

Catalog No. ABIN631824

The Rabbit Polyclonal anti-FBXW10 antibody (ABIN631824) specifically detects FBXW10 in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for FBXW10 antibody (Middle Region) (ABIN631824)

Target: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXW10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXW10 Antibody

Binding Specificity: Middle Region

Specificity: FBXW10 antibody was raised against the middle region of FBXW10

Purification: Affinity purified

Immunogen: FBXW10 antibody was raised using the middle region of FBXW10 corresponding to a region with amino acids RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXW10 Blocking Peptide, (ABIN5613553), is also available for use as a blocking control in assays to test for specificity of this FBXW10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXW10

Target: FBXW10 (F-Box and WD Repeat Domain Containing 10 (FBXW10))

Alternative Name: FBXW10

Background: Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 120 kDa (MW of target protein)