ANKLE2 antibody (Middle Region)
-
- Target See all ANKLE2 products
- ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ANKLE2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KIAA0692 antibody was raised against the middle region of Kiaa0692
- Purification
- Affinity purified
- Immunogen
- KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KIAA0692 Blocking Peptide, catalog no. 33R-1839, is also available for use as a blocking control in assays to test for specificity of this KIAA0692 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0692 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ANKLE2 (Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2))
- Alternative Name
- KIAA0692 (ANKLE2 Products)
- Synonyms
- KIAA0692 antibody, LEMD7 antibody, Lem4 antibody, 1110001J12Rik antibody, AI661024 antibody, D5Ertd585e antibody, RGD1310191 antibody, ankyrin repeat and LEM domain containing 2 antibody, ANKLE2 antibody, Ankle2 antibody
- Background
- KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown.
- Molecular Weight
- 104 kDa (MW of target protein)
-