TBCK antibody (Middle Region)

Catalog No. ABIN631832

Product Details anti-TBCK Antibody

Target: TBCK (TBC1 Domain Containing Kinase (TBCK))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TBCK antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MGC16169 antibody was raised against the middle region of Mgc16169

Purification: Affinity purified

Immunogen: MGC16169 antibody was raised using the middle region of Mgc16169 corresponding to a region with amino acids PPICTLPNFLFEDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC16169 Blocking Peptide, catalog no. 33R-7258, is also available for use as a blocking control in assays to test for specificity of this MGC16169 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC16169 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TBCK

Target: TBCK (TBC1 Domain Containing Kinase (TBCK))

Abstract: TBCK Products

Synonyms: Tbckl antibody, RGD1307816 antibody, tbckl antibody, hspc302 antibody, MGC82809 antibody, im:7138354 antibody, wu:fc74a10 antibody, zgc:158710 antibody, MGC122549 antibody, TBCKL antibody, 1700120J03Rik antibody, 9430001M19 antibody, A630047E20Rik antibody, C030007I09Rik antibody, TBC1 domain containing kinase antibody, TBC1 domain containing kinase L homeolog antibody, Tbck antibody, tbck.L antibody, TBCK antibody, tbck antibody

Background: The function of MGC16169 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 94 kDa (MW of target protein)