NOP16 antibody (Middle Region)

Catalog No. ABIN631833

This anti-NOP16 antibody is a Rabbit Polyclonal antibody detecting NOP16 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for NOP16 antibody (Middle Region) (ABIN631833)

Target: NOP16 (Nucleolar Protein 16 (NOP16))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOP16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NOP16 Antibody

Binding Specificity: Middle Region

Specificity: HSPC111 antibody was raised against the middle region of HSPC111

Purification: Affinity purified

Immunogen: HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPC111 Blocking Peptide, (ABIN5614109), is also available for use as a blocking control in assays to test for specificity of this HSPC111 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPC111 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOP16

Target: NOP16 (Nucleolar Protein 16 (NOP16))

Alternative Name: HSPC111

Background: NOP16 is transcriptionally regulated by c-Myc, upregulated in breast cancer, and overexpression is associated with poor patient survival.

Molecular Weight: 21 kDa (MW of target protein)