PYROXD2 antibody (N-Term)

Catalog No. ABIN631834

Product Details anti-PYROXD2 Antibody

Target: PYROXD2 (C10ORF33) (Chromosome 10 Open Reading Frame 33 (C10ORF33))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PYROXD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C10 ORF33 antibody was raised against the N terminal Of C10 rf33

Purification: Affinity purified

Immunogen: C10 ORF33 antibody was raised using the N terminal Of C10 rf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10ORF33 Blocking Peptide, catalog no. 33R-5610, is also available for use as a blocking control in assays to test for specificity of this C10ORF33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PYROXD2

Target: PYROXD2 (C10ORF33) (Chromosome 10 Open Reading Frame 33 (C10ORF33))

Alternative Name: C10ORF33 (C10ORF33 Products)

Synonyms: C10orf33 antibody, DKFZp469H0233 antibody, FP3420 antibody, C26H10orf33 antibody, 3830409H07Rik antibody, 4833409A17Rik antibody, RGD1303232 antibody, pyridine nucleotide-disulphide oxidoreductase domain 2 antibody, PYROXD2 antibody, Pyroxd2 antibody

Background: C10orf33 is probably involved in oxidoreductase activity.

Molecular Weight: 63 kDa (MW of target protein)