PRRC1 antibody (Middle Region)

Catalog No. ABIN631835

The Rabbit Polyclonal anti-PRRC1 antibody is suitable to detect PRRC1 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PRRC1 antibody (Middle Region) (ABIN631835)

Target: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRRC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PRRC1 Antibody

Binding Specificity: Middle Region

Specificity: PRRC1 antibody was raised against the middle region of PRRC1

Purification: Affinity purified

Immunogen: PRRC1 antibody was raised using the middle region of PRRC1 corresponding to a region with amino acids VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRRC1 Blocking Peptide, (ABIN5615596), is also available for use as a blocking control in assays to test for specificity of this PRRC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRRC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRRC1

Target: PRRC1 (Proline-Rich Coiled-Coil 1 (PRRC1))

Alternative Name: PRRC1

Background: The specific function of PRRC1 is not yet known.

Molecular Weight: 47 kDa (MW of target protein)