Phosphoglucomutase 3 antibody (Middle Region)

Catalog No. ABIN631841

The Rabbit Polyclonal anti-Phosphoglucomutase 3 antibody has been validated for WB. It is suitable to detect Phosphoglucomutase 3 in samples from Human, Mouse and Rat.

Quick Overview for Phosphoglucomutase 3 antibody (Middle Region) (ABIN631841)

Target: Phosphoglucomutase 3 (PGM3)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Phosphoglucomutase 3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Phosphoglucomutase 3 Antibody

Binding Specificity: Middle Region

Specificity: PGM3 antibody was raised against the middle region of PGM3

Purification: Affinity purified

Immunogen: PGM3 antibody was raised using the middle region of PGM3 corresponding to a region with amino acids GVVQTAYANGSSTRYLEEVMKVPVYCTKTGVKHLHHKAQEFDIGVYFEAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGM3 Blocking Peptide, (ABIN939046), is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Phosphoglucomutase 3

Target: Phosphoglucomutase 3 (PGM3)

Alternative Name: PGM3

Background: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Molecular Weight: 60 kDa (MW of target protein)