THOC6 antibody

Catalog No. ABIN631845

This anti-THOC6 antibody is a Rabbit Polyclonal antibody detecting THOC6 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for THOC6 antibody (ABIN631845)

Target: THOC6 (THO Complex 6 Homolog (THOC6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This THOC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-THOC6 Antibody

Purification: Affinity purified

Immunogen: THOC6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

THOC6 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this THOC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THOC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for THOC6

Target: THOC6 (THO Complex 6 Homolog (THOC6))

Alternative Name: THOC6

Background: THOC6 belongs to the WD repeat THOC6 family.It contains 7 WD repeats. The function of the THOC6 protein remains unknown.

Molecular Weight: 37 kDa (MW of target protein)