AASDH antibody (Middle Region)

Catalog No. ABIN631854

This anti-AASDH antibody is a Rabbit Polyclonal antibody detecting AASDH in WB. Suitable for Human, Mouse and Rat.

Quick Overview for AASDH antibody (Middle Region) (ABIN631854)

Target: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AASDH antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AASDH Antibody

Binding Specificity: Middle Region

Specificity: AASDH antibody was raised against the middle region of AASDH

Purification: Affinity purified

Immunogen: AASDH antibody was raised using the middle region of AASDH corresponding to a region with amino acids TDGKVWILESQSGQLQSVYELPGEVFSSPVVLESMLIIGCRDNYVYCLDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AASDH Blocking Peptide, (ABIN5611848), is also available for use as a blocking control in assays to test for specificity of this AASDH antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AASDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AASDH

Target: AASDH (Aminoadipate-Semialdehyde Dehydrogenase (AASDH))

Alternative Name: AASDH

Background: Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA.

Molecular Weight: 122 kDa (MW of target protein)