CCDC38 antibody (N-Term)

Catalog No. ABIN631855

This Rabbit Polyclonal antibody specifically detects CCDC38 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CCDC38 antibody (N-Term) (ABIN631855)

Target: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC38 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC38 Antibody

Binding Specificity: N-Term

Specificity: CCDC38 antibody was raised against the N terminal of CCDC38

Purification: Affinity purified

Immunogen: CCDC38 antibody was raised using the N terminal of CCDC38 corresponding to a region with amino acids RERQLKKAEKKLQDDALAFEEFLRENDQRSVDALKMAAQETINKLQMTAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC38 Blocking Peptide, (ABIN5612709), is also available for use as a blocking control in assays to test for specificity of this CCDC38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC38

Target: CCDC38 (Coiled-Coil Domain Containing 38 (CCDC38))

Alternative Name: CCDC38

Background: The specific function of CCDC38 is not yet known.

Molecular Weight: 65 kDa (MW of target protein)